Discussions Q&R

Any one using kaggle for AI studying?
kagglepython
0 Vote
1 Réponse
5th Sep 2017, 4:57 PM
Abhijith Krishnan
Abhijith Krishnan - avatar
How to use Kaggle to learn about Data Science?
kagglepython
1 Vote
1 Réponse
19th Apr 2019, 1:19 PM
Ádám Tóth
Ádám Tóth - avatar
How to use kaggle dataset in colab without downloading it
colabdatasetkagglekernalmachinelearningmlmodelpython
1 Vote
1 Réponse
10th Sep 2020, 3:56 AM
Saurabh Khade
Saurabh Khade - avatar
How to use Kaggle Datasets in Google Colab. notebook, and use them in PyTorch?
google-colabpython3pytorch
7 Votes
2 Réponses
5th Dec 2019, 7:01 AM
Aanisha Bhattacharyya
Aanisha Bhattacharyya - avatar
What do people think about Kaggle?
kagglepython
23 Votes
6 Réponses
1st May 2017, 6:17 PM
Hukilaura
Hukilaura - avatar
How to take datasets from kaggle if I wanted to use them on sololearn...as I'm using sololearn in android.
csvdatasetskagglemachinelearningpython3
2 Votes
5 Réponses
19th Oct 2021, 6:08 AM
Isha
Conways game of life output is blank on mu editor and Sololearn but shows up in Kaggle
begginerpython
0 Vote
2 Réponses
21st Sep 2021, 12:20 PM
jordan carter
jordan carter - avatar
Aujourd'hui en vedette
Fast coding (mobile)
1 Votes
..
1 Votes
Beginner_to_SoloLearn
2 Votes
How to learn C++ and how long does it take
1 Votes
Coding help
2 Votes
DSA doubt
1 Votes
Bridge pattern use case
0 Votes
Recover challenge history
0 Votes
Hofstadter a sequence code coach is not running
0 Votes
Data structure using C
0 Votes