Discussions Q&R

Datasets
datasets
0 Vote
1 Réponse
25th Sep 2018, 2:00 PM
lakshya mishra
lakshya mishra - avatar
Load datasets and check them
r
-6 Votes
2 Réponses
11th Sep 2021, 6:29 AM
Zoha Khan
Open Machine Learning Challenges with downloadable real datasets - ENS
challengesdatalearningmachinemlscience
11 Votes
4 Réponses
10th May 2018, 10:23 PM
Cépagrave
Cépagrave - avatar
How to use Kaggle Datasets in Google Colab. notebook, and use them in PyTorch?
google-colabpython3pytorch
7 Votes
2 Réponses
5th Dec 2019, 7:01 AM
Aanisha Bhattacharyya
Aanisha Bhattacharyya - avatar
Please someone can suggest some new datasets on which i can apply machine learning algorithms.
anacondaartificial-intelligencemachine-learningpython3
4 Votes
10 Réponses
30th Jun 2018, 1:58 PM
Astha Maurya
Astha Maurya - avatar
How to visualize bdf eeg datasets ? Like in excel like table in python for example
bdfeegmnepython
1 Vote
1 Réponse
12th Jun 2021, 5:34 PM
Zhenis Otarbay
Zhenis Otarbay - avatar
How to take datasets from kaggle if I wanted to use them on sololearn...as I'm using sololearn in android.
csvdatasetskagglemachinelearningpython3
2 Votes
5 Réponses
19th Oct 2021, 6:08 AM
Isha
Can I use the functions of this class if so how?
datasetsmachine-learningpython3
0 Vote
2 Réponses
30th Nov 2020, 9:17 PM
Zhenis Otarbay
Zhenis Otarbay - avatar
Communities to discuss finetuning LLMs
datasetsfinetuningllm
1 Vote
1 Réponse
24th May 2025, 5:32 AM
Danila 🧊
Danila 🧊 - avatar
I was trying to use mne to apply filtering for brain data which is in mat, what do I do here?
datasetsmachine-learningpython3
2 Votes
1 Réponse
30th Nov 2020, 7:18 PM
Zhenis Otarbay
Zhenis Otarbay - avatar
How to load mat dataset using mne? I usually loaded fif and pickle files to colab using me can you tell? For example, I used pic
datasetsmachine-learningpython3
2 Votes
1 Réponse
30th Nov 2020, 3:26 PM
Zhenis Otarbay
Zhenis Otarbay - avatar
OpenML not loading the second time
dataframedatasetsmachine-learningopenmlpandaspythonsklearn
3 Votes
2 Réponses
17th May 2021, 6:05 AM
Clueless Coder
Clueless Coder - avatar
Aujourd'hui en vedette
Hofstadter a sequence code coach is not running
0 Votes
DSA doubt
1 Votes
Vote Code
1 Votes
the code for bigneer is not really what to do after coding begeneer in sololearn
0 Votes
Input errors (python)
1 Votes
I wanna know is that what about dot net developers in future there is possible they gonna downfall in industry
0 Votes
Without degree job
0 Votes
Data structure using C
0 Votes
How can I add gradient to the background
0 Votes
Html learn
1 Votes