Courses
LoginStart now
Courses
LoginStart now

Sesiones de PyR

Mernstack firebase
firebase
0 Votos
5 Respuestas
23rd Apr 2025, 3:57 AM
Kunal
Kunal - avatar
How to be a MERN stack developer if someone is complete beginner?
mernstackprogrammingwebdevelopment
0 Votos
2 Respuestas
14th Mar 2021, 5:32 AM
bossCoder
bossCoder - avatar
Is MERN stack development is in trend ?
angularjavascriptmeanstackmernstackpythonreactwebdevelopment
1 Voto
6 Respuestas
6th Feb 2020, 9:46 AM
Bhavleen Singh Manaktala
Bhavleen Singh Manaktala - avatar
En tendencia hoy
Hofstadter a sequence code coach is not running
0 Votes
DSA doubt
1 Votes
Vote Code
1 Votes
the code for bigneer is not really what to do after coding begeneer in sololearn
0 Votes
I wanna know is that what about dot net developers in future there is possible they gonna downfall in industry
0 Votes
Input errors (python)
1 Votes
Data structure using C
0 Votes
Without degree job
0 Votes
How can I add gradient to the background
0 Votes
Html learn
1 Votes