Sesiones de PyR

Full Stack Developer
backenddesigningfront-endfullstackmeanstackwebwebdevelopment
2 Votos
2 Respuestas
14th Feb 2018, 7:02 PM
Abdul Samad PA
Abdul Samad PA - avatar
Is MERN stack development is in trend ?
angularjavascriptmeanstackmernstackpythonreactwebdevelopment
1 Voto
6 Respuestas
6th Feb 2020, 9:46 AM
Bhavleen Singh Manaktala
Bhavleen Singh Manaktala - avatar
Best MEAN JavaScript resources?
bestjavascriptlearnmeanmeanstackresources
0 Votos
1 Respuesta
22nd Jun 2018, 9:12 PM
Daniel Zuluaga
Daniel Zuluaga - avatar
What is MEAN STACK development. What are best free sources to learn MEAN STACK development.
angular.jsdevelopmentexpress.jsmangodbmeanstacknode.jsweb
1 Voto
2 Respuestas
8th Jul 2018, 11:05 AM
Manish Bainsla
What would findOne() in mongoDB return if the record does not exists?
angularmeanmeanstackmongomongodbmongooseweb-storage
0 Votos
1 Respuesta
20th May 2018, 3:21 PM
Ashutosh
Ashutosh - avatar
En tendencia hoy
Fast coding (mobile)
1 Votes
..
1 Votes
Beginner_to_SoloLearn
2 Votes
DSA doubt
1 Votes
Coding help
2 Votes
Bridge pattern use case
0 Votes
Hofstadter a sequence code coach is not running
0 Votes
Data structure using C
0 Votes
Input errors (python)
1 Votes
the code for bigneer is not really what to do after coding begeneer in sololearn
0 Votes