Q&A Discussions

Mernstack firebase
firebase
0 Votes
5 Answers
23rd Apr 2025, 3:57 AM
Kunal
Kunal - avatar
How to be a MERN stack developer if someone is complete beginner?
mernstackprogrammingwebdevelopment
0 Votes
2 Answers
14th Mar 2021, 5:32 AM
bossCoder
bossCoder - avatar
Is MERN stack development is in trend ?
angularjavascriptmeanstackmernstackpythonreactwebdevelopment
1 Vote
6 Answers
6th Feb 2020, 9:46 AM
Bhavleen Singh Manaktala
Bhavleen Singh Manaktala - avatar
Hot today
Fast coding (mobile)
1 Votes
..
1 Votes
Beginner_to_SoloLearn
2 Votes
How to learn C++ and how long does it take
1 Votes
Coding help
2 Votes
DSA doubt
1 Votes
Bridge pattern use case
0 Votes
Recover challenge history
0 Votes
Hofstadter a sequence code coach is not running
0 Votes
Data structure using C
0 Votes