Обсуждения

htaccess PHP
htaccessphpphp7url
1 голос
2 ответов
7th Mar 2019, 1:36 PM
coding-space.ru
coding-space.ru - avatar
404 Catching without htaccess
404htaccessphprewrite
2 голосов
2 ответов
3rd Dec 2017, 3:59 AM
AA Shakil
AA Shakil - avatar
Url rewrite without htaccess
phprewrite
1 голос
1 ответ
1st Dec 2017, 12:53 PM
AA Shakil
AA Shakil - avatar
What is htaccess and what are it benifits??
htaccessphpweb_developerwebsite
0 голосов
2 ответов
12th Jan 2017, 3:37 PM
Raju Master
Raju Master - avatar
What code should be added When edit redirect http to https in htaccess ?
php
1 голос
1 ответ
31st May 2020, 12:50 PM
Abdulsalam Al-Ashwal
Abdulsalam Al-Ashwal - avatar
Do my .htaccess file is downloadable ?
htaccess
1 голос
2 ответов
20th Apr 2017, 8:32 PM
Maria
Maria - avatar
Custom URLs
htaccess
1 голос
1 ответ
31st Jan 2018, 1:16 AM
epic gamer
epic gamer - avatar
how to change default favicon
faviconhtaccess
1 голос
2 ответов
15th Jun 2019, 5:00 AM
nicolas turek
nicolas turek - avatar
How to remove .html extension from the URL using .htaccess (but it’s challenging)
.htmlextensionhtaccesshtmlurlweb
0 голосов
8 ответов
10th Mar 2021, 2:36 AM
Ginfio
Ginfio - avatar
.htaccess - How to disable (?code=$1)
htaccesshttpsredirectedrewriteshorturl
1 голос
2 ответов
21st Nov 2018, 2:03 PM
Wesley de Bruin
Wesley de Bruin - avatar
.htaccess config for accessing files without extentions
404accessapacheconfigextentionsfilehtaccessrequestresponseserver
25 голосов
9 ответов
30th Jun 2019, 2:26 PM
Sarthak Pokhrel
Sarthak Pokhrel - avatar
What are the good frameworks in PHP
framewowkhtaccessphpphp.inisecurity
0 голосов
4 ответов
12th Jan 2017, 3:05 PM
UmAr KhAn
UmAr KhAn - avatar
How to change links like index.php/?id=1234 to index.php/1234 or index/1234
changegethosthtaccesslinkspermalinkphp
1 голос
3 ответов
14th Apr 2017, 8:39 AM
Oyeniyi Abiola Peace
Oyeniyi Abiola Peace - avatar
How to change PHP version to work with Apache server in Linux
apachecontainerhtaccesslamplinuxlocalhostmysqlphpwebserverwebsite
1 голос
3 ответов
15th Feb 2022, 10:27 PM
Hans Dürr
Hans Dürr - avatar
Convert php links
browsercsshavehtaccesshtmllinkphpsql
1 голос
2 ответов
1st Oct 2016, 4:31 PM
Driss Baidou
Driss Baidou - avatar
Актуальное сегодня
Hofstadter a sequence code coach is not running
0 Votes
DSA doubt
1 Votes
Vote Code
1 Votes
the code for bigneer is not really what to do after coding begeneer in sololearn
0 Votes
I wanna know is that what about dot net developers in future there is possible they gonna downfall in industry
0 Votes
Input errors (python)
1 Votes
Data structure using C
0 Votes
Without degree job
0 Votes
How can I add gradient to the background
0 Votes
Html learn
1 Votes