Courses
LoginStart now
Courses
LoginStart now

Q&A Discussões

About searching in dataset using python or R
daskdataframedatasetpandaspythonpython3rrstudiosearching
2 Votos
1 Resposta
23rd Dec 2020, 4:19 PM
Nikita Desale
Nikita Desale - avatar
Quente hoje
Hofstadter a sequence code coach is not running
0 Votes
DSA doubt
1 Votes
the code for bigneer is not really what to do after coding begeneer in sololearn
0 Votes
Input errors (python)
1 Votes
Data structure using C
0 Votes
Vote Code
1 Votes
Without degree job
0 Votes
I wanna know is that what about dot net developers in future there is possible they gonna downfall in industry
0 Votes
Welcome to my portfolio. Here you'll find a collection of my projects and creations. I specialize in [Your Specialization, e.g.
0 Votes
How can I add gradient to the background
0 Votes