Dyskusje Q&A

Newbie, what to do next?
programmingscriptkiddieself-learningvisual-studio
1 Głos
1 Odpowiedź
15th May 2018, 1:19 AM
Boli 🇸🇪
Boli 🇸🇪 - avatar
Do you feeling that Sololearn is better than Stackoverflow ?
announcementjokememenewcomernoobrandomscriptkiddie
0 głosów
2 odpowiedzi
23rd Jul 2019, 3:29 PM
Ullman
Ullman - avatar
Popularne dzisiaj
Fast coding (mobile)
2 Votes
Hofstadter a sequence code coach is not running
0 Votes
DSA doubt
1 Votes
Coding help
2 Votes
Bridge pattern use case
0 Votes
the code for bigneer is not really what to do after coding begeneer in sololearn
0 Votes
Input errors (python)
1 Votes
Data structure using C
0 Votes
Vote Code
1 Votes
Without degree job
0 Votes