Courses
LoginStart now
Courses
LoginStart now

Discussions Q&R

Mernstack firebase
firebase
0 Vote
5 Réponses
23rd Apr 2025, 3:57 AM
Kunal
Kunal - avatar
How to be a MERN stack developer if someone is complete beginner?
mernstackprogrammingwebdevelopment
0 Vote
2 Réponses
14th Mar 2021, 5:32 AM
bossCoder
bossCoder - avatar
Is MERN stack development is in trend ?
angularjavascriptmeanstackmernstackpythonreactwebdevelopment
1 Vote
6 Réponses
6th Feb 2020, 9:46 AM
Bhavleen Singh Manaktala
Bhavleen Singh Manaktala - avatar
Aujourd'hui en vedette
Hofstadter a sequence code coach is not running
0 Votes
DSA doubt
1 Votes
Vote Code
1 Votes
the code for bigneer is not really what to do after coding begeneer in sololearn
0 Votes
Input errors (python)
1 Votes
I wanna know is that what about dot net developers in future there is possible they gonna downfall in industry
0 Votes
Without degree job
0 Votes
Data structure using C
0 Votes
Je cherche des gens qui parle français pour apprendre le langage c
0 Votes
Html learn
1 Votes