Courses
LoginStart now
Courses
LoginStart now

Discussions Q&R

Codeignitor : Errors are not showing |
php
0 Vote
1 Réponse
29th May 2018, 4:58 PM
Saurav Kumar
Saurav Kumar - avatar
How do we program for notification like facebok in codeignitor (php framework)?
facebookmysqlnotificationphp
11 Votes
2 Réponses
29th Apr 2019, 5:11 AM
Prince Raj
Prince Raj - avatar
Need of better Framework for Web Development : Codeignitor or laravel
developmentjavascriptmysqlphpphpmyadminpythonscriptingscripting-languagesweb
1 Vote
2 Réponses
17th May 2017, 6:38 PM
Sahil Singh
Sahil Singh - avatar
How do we program to sent and accept friend request is codeignitor php framework?
codeignitorloopsmysqloopphp
11 Votes
1 Réponse
29th Apr 2019, 5:08 AM
Prince Raj
Prince Raj - avatar
What are the main differences between Laravel & CodeIgnitor frameworks? I have used Codeignitor.
phpwebsite
1 Vote
3 Réponses
6th Oct 2020, 8:55 AM
Dimuthu Dhanushka
Dimuthu Dhanushka - avatar
How encryption is different from slugify?
codeignitordjangoencryptionetclaravelphppython3slugifyurl_router
18 Votes
5 Réponses
28th May 2019, 7:50 AM
Prince Raj
Prince Raj - avatar
what will the unique idea to call time and date in php from database using mysql or mysqli either any php framework?
codeignitordatabasedateidealaravelmysqlmysqliphptimeunique
15 Votes
2 Réponses
24th May 2019, 4:26 PM
Prince Raj
Prince Raj - avatar
Best php framework?
backendcodeignitorframeworklaracastlaravelotwellphpserverserver-sidesymfonytayloryiizend
1 Vote
1 Réponse
22nd Nov 2016, 10:10 PM
Masoud Jahromi
Masoud Jahromi - avatar
Aujourd'hui en vedette
Fast coding (mobile)
1 Votes
..
1 Votes
Beginner_to_SoloLearn
2 Votes
How to learn C++ and how long does it take
1 Votes
Coding help
2 Votes
DSA doubt
1 Votes
Bridge pattern use case
0 Votes
Hofstadter a sequence code coach is not running
0 Votes
Recover challenge history
0 Votes
Data structure using C
0 Votes