Q&A Discussions

Wtf
help
2 Votes
2 Answers
2nd Jun 2017, 9:46 PM
Bryan
Wtf is this:(1+_)**2=16
numeric-operationspython
3 Votes
12 Answers
14th Sep 2017, 9:16 AM
Alban Taraire
Alban Taraire - avatar
Wtf error
errorjava
1 Vote
2 Answers
16th Oct 2017, 11:11 PM
Médi Olivier
Médi Olivier - avatar
Wtf with html5?
htmlhtml5web-storage
0 Votes
3 Answers
30th Jan 2017, 2:37 PM
Fantasy Yahya
Fantasy Yahya - avatar
wtf is wifi
bluetoothnetworkwifi
-4 Votes
2 Answers
21st Jul 2021, 3:31 AM
hadaly P
wtf does increment mean
c++increment
0 Votes
2 Answers
6th Aug 2019, 1:56 PM
Des meister
Des meister - avatar
Who else dropped drastically in ranks wtf
rank
1 Vote
6 Answers
2nd Apr 2017, 4:36 PM
chidera innocent
chidera innocent - avatar
WTF is wrong with my code?!
forjavaloops
-3 Votes
2 Answers
2nd Mar 2017, 4:40 PM
Wildman Fizat
Wildman Fizat - avatar
How can u guy made animations only by coding??
wtf
0 Votes
4 Answers
30th Oct 2019, 3:44 PM
Phạm Đức
Phạm Đức - avatar
Some explain this to me, i dont know wtf im doing and its so simple.
javascript
0 Votes
5 Answers
7th Feb 2017, 7:20 PM
michael
All course progress gone
courseprogresswtf
0 Votes
1 Answer
17th Jul 2020, 10:44 AM
Ruben Sardaryan
Ruben Sardaryan - avatar
In challenge I am getting 5-9 exp+ for a win and getting 20-28 exp reduction for each lose . WTF is wrong with Sololearn?
challangeexp
1 Vote
5 Answers
24th Jul 2020, 2:26 AM
Khalid Shifullah
Khalid Shifullah - avatar
Another error...... Need help again :( code in comment section, error in description
helpidkpythonwtfwtf
3 Votes
26 Answers
17th Mar 2018, 12:28 AM
1337 H4x0r
1337 H4x0r - avatar
Wtf is going on with the storing charactors for variables? Idk how to even start to edit the code theres nothing to help idk
alphabettoabcdefghijklmnopqrstuvwxyzvariables
0 Votes
3 Answers
18th Feb 2023, 5:39 PM
Katherine Rodrriguez
Katherine Rodrriguez - avatar
I adore JS😀👍
awesomeawfuljavascriptwtf
15 Votes
2 Answers
14th Jan 2018, 9:00 PM
\__(° = °)__/
Which programm use to learn How to program PC GAMES ?
don'tknowanithinggamesprogrammwtf
1 Vote
10 Answers
5th Dec 2017, 1:55 PM
Deez Hares
Deez Hares - avatar
У меня одного не видно комментарии?
hardbagsolonocomentwtf
0 Votes
2 Answers
15th May 2022, 5:31 PM
Миролюбов Герман Анри
Миролюбов Герман Анри - avatar
что не так?! what is wrong?!
helphtmlvideowtf
2 Votes
4 Answers
11th Apr 2020, 7:07 AM
Евдокимов Дмитрий
Евдокимов Дмитрий - avatar
Wtf when I run this code it gives me an error of indented block...i tried it several time but in vein. What is indented?
loopspython
0 Votes
2 Answers
5th May 2017, 4:20 PM
Shah Zaib
Shah Zaib - avatar
Array Properties & Methods problem with compiler
c#compilererrorfailedprowtf
0 Votes
1 Answer
1st Jun 2023, 2:45 PM
Kamil Kuształa
Theme
authorslookSkinthemewtf
-10 Votes
3 Answers
28th Oct 2017, 7:55 PM
Krzysztof Zieliński
Krzysztof Zieliński - avatar
This is simple html, but I'm trying to learn CSS. I'm just not transitioning well. How would the appropriate CSS look? PLZ HELP!
attributescssformattinghelphtmlidkmepleasestylingwtf
2 Votes
4 Answers
18th Apr 2020, 11:28 PM
Cassandra Sawden
Cassandra Sawden - avatar
Hot today
Fast coding (mobile)
1 Votes
..
1 Votes
Beginner_to_SoloLearn
2 Votes
How to learn C++ and how long does it take
1 Votes
Coding help
2 Votes
DSA doubt
1 Votes
Bridge pattern use case
0 Votes
Recover challenge history
0 Votes
Data structure using C
0 Votes
Hofstadter a sequence code coach is not running
0 Votes