Q&A Discussions

Why doesn't C# KeyValuePair work in Sololearn's code playground
c#keyvaluepairsololearn
0 Votes
1 Answer
17th Feb 2022, 12:11 AM
Godfred Opintan
Godfred Opintan - avatar
Implementing Key-Value-Store
databasehelpjavakeyvaluekeyvaluepairkeyvaluestorekvs
3 Votes
9 Answers
12th May 2020, 10:38 PM
Terminatez
Find_first_of and find_first_not_of
cppfunckeyvaluepairstring
1 Vote
1 Answer
10th Mar 2018, 8:49 AM
Lee Yao Dong
Lee Yao Dong - avatar
What are the different scenarios where I should use List<KeyValuePair<>> instead of Dictionary<>?
c#dictionariesdifferencegenericshashmapkeyvaluepairlist
4 Votes
1 Answer
17th May 2018, 7:36 PM
Rusty.Metal
Hot today
Fast coding (mobile)
1 Votes
..
1 Votes
Beginner_to_SoloLearn
2 Votes
How to learn C++ and how long does it take
1 Votes
Coding help
2 Votes
DSA doubt
1 Votes
Bridge pattern use case
0 Votes
Hofstadter a sequence code coach is not running
0 Votes
Recover challenge history
0 Votes
Data structure using C
0 Votes