Q&A Discussions

How to learn canva
canvas
0 Votes
2 Answers
19th Sep 2021, 5:50 AM
Zahid Zahid
add button with canva
canvashtml5
-2 Votes
1 Answer
13th Nov 2016, 10:01 PM
De Ve Ce
De Ve Ce - avatar
Js Test on Canva doesn't show up
codecodingcssdevelopmenthtmljavascriptjsweb
0 Votes
3 Answers
28th Jun 2022, 8:27 AM
Diana
How to draw canva animation and svg easily and faster
animationcanvadraweasilyhelphtmlshapesimplesvgway
15 Votes
4 Answers
30th Apr 2019, 7:56 PM
Aryan Verma
Aryan Verma - avatar
How Much CSS or Javascript [or coding] went into Canva
codecsshtmljavascriptwww.canva.com
0 Votes
3 Answers
12th Feb 2017, 7:39 PM
BrightAsTheStars
Hot today
Hofstadter a sequence code coach is not running
0 Votes
DSA doubt
1 Votes
Vote Code
1 Votes
the code for bigneer is not really what to do after coding begeneer in sololearn
0 Votes
Input errors (python)
1 Votes
I wanna know is that what about dot net developers in future there is possible they gonna downfall in industry
0 Votes
Without degree job
0 Votes
Data structure using C
0 Votes
Je cherche des gens qui parle français pour apprendre le langage c
0 Votes
How can I add gradient to the background
0 Votes