Courses
LoginStart now
Courses
LoginStart now

Q&A Discussions

Differentiate frontend and backend languages and their relation too
angfrcripting-languagecssfrontenfrontendhtmljavajavascriptmysqlphphpscripting-languagessql
2 Votes
2 Answers
28th Jan 2018, 8:03 AM
Koushik G Shashidhar
Koushik G Shashidhar - avatar
Hot today
Fast coding (mobile)
2 Votes
Hofstadter a sequence code coach is not running
0 Votes
DSA doubt
1 Votes
Coding help
2 Votes
the code for bigneer is not really what to do after coding begeneer in sololearn
0 Votes
Input errors (python)
1 Votes
Data structure using C
0 Votes
Vote Code
1 Votes
Without degree job
0 Votes
I wanna know is that what about dot net developers in future there is possible they gonna downfall in industry
0 Votes