Courses
LoginStart now
Courses
LoginStart now

F&A Diskussionen

Why doesn't C# KeyValuePair work in Sololearn's code playground
c#keyvaluepairsololearn
0 Stimmen
1 Antwort
17th Feb 2022, 12:11 AM
Godfred Opintan
Godfred Opintan - avatar
Implementing Key-Value-Store
databasehelpjavakeyvaluekeyvaluepairkeyvaluestorekvs
3 Stimmen
9 Antworten
12th May 2020, 10:38 PM
Terminatez
Find_first_of and find_first_not_of
cppfunckeyvaluepairstring
1 Stimme
1 Antwort
10th Mar 2018, 8:49 AM
Lee Yao Dong
Lee Yao Dong - avatar
What are the different scenarios where I should use List<KeyValuePair<>> instead of Dictionary<>?
c#dictionariesdifferencegenericshashmapkeyvaluepairlist
4 Stimmen
1 Antwort
17th May 2018, 7:36 PM
Rusty.Metal
Heute heiß
Hofstadter a sequence code coach is not running
0 Votes
DSA doubt
1 Votes
Vote Code
1 Votes
the code for bigneer is not really what to do after coding begeneer in sololearn
0 Votes
Input errors (python)
1 Votes
I wanna know is that what about dot net developers in future there is possible they gonna downfall in industry
0 Votes
Without degree job
0 Votes
Data structure using C
0 Votes
Je cherche des gens qui parle français pour apprendre le langage c
0 Votes
How can I add gradient to the background
0 Votes