Courses
LoginStart now
Courses
LoginStart now

Обсуждения

Newbie, what to do next?
programmingscriptkiddieself-learningvisual-studio
1 голос
1 ответ
15th May 2018, 1:19 AM
Boli 🇸🇪
Boli 🇸🇪 - avatar
Do you feeling that Sololearn is better than Stackoverflow ?
announcementjokememenewcomernoobrandomscriptkiddie
0 голосов
2 ответов
23rd Jul 2019, 3:29 PM
Ullman
Ullman - avatar
Актуальное сегодня
Hofstadter a sequence code coach is not running
0 Votes
DSA doubt
1 Votes
the code for bigneer is not really what to do after coding begeneer in sololearn
0 Votes
Input errors (python)
1 Votes
Data structure using C
0 Votes
Vote Code
1 Votes
Without degree job
0 Votes
I wanna know is that what about dot net developers in future there is possible they gonna downfall in industry
0 Votes
Welcome to my portfolio. Here you'll find a collection of my projects and creations. I specialize in [Your Specialization, e.g.
0 Votes
How can I add gradient to the background
0 Votes