Courses
LoginStart now
Courses
LoginStart now

Обсуждения

Sklearn Bug
arraydata-typesdataframelogisticnumpypandaspythonpython3regressionsklearn
1 голос
2 ответов
18th Jul 2020, 9:22 AM
Clueless Coder
Clueless Coder - avatar
About searching in dataset using python or R
daskdataframedatasetpandaspythonpython3rrstudiosearching
2 голосов
1 ответ
23rd Dec 2020, 4:19 PM
Nikita Desale
Nikita Desale - avatar
< Предыдущий12Следующий >
Актуальное сегодня
Hofstadter a sequence code coach is not running
0 Votes
DSA doubt
1 Votes
the code for bigneer is not really what to do after coding begeneer in sololearn
0 Votes
Input errors (python)
1 Votes
Data structure using C
0 Votes
Vote Code
1 Votes
Without degree job
0 Votes
I wanna know is that what about dot net developers in future there is possible they gonna downfall in industry
0 Votes
Welcome to my portfolio. Here you'll find a collection of my projects and creations. I specialize in [Your Specialization, e.g.
0 Votes
How can I add gradient to the background
0 Votes