Courses
LoginStart now
Courses
LoginStart now

Q&A Discussões

Sklearn Bug
arraydata-typesdataframelogisticnumpypandaspythonpython3regressionsklearn
1 Voto
2 Respostas
18th Jul 2020, 9:22 AM
Clueless Coder
Clueless Coder - avatar
About searching in dataset using python or R
daskdataframedatasetpandaspythonpython3rrstudiosearching
2 Votos
1 Resposta
23rd Dec 2020, 4:19 PM
Nikita Desale
Nikita Desale - avatar
< Anterior12Próximo >
Quente hoje
Fast coding (mobile)
2 Votes
Hofstadter a sequence code coach is not running
0 Votes
DSA doubt
1 Votes
Coding help
2 Votes
Bridge pattern use case
0 Votes
the code for bigneer is not really what to do after coding begeneer in sololearn
0 Votes
Input errors (python)
1 Votes
Data structure using C
0 Votes
Vote Code
1 Votes
Without degree job
0 Votes