Courses
LoginStart now
Courses
LoginStart now
0

Package vs library ??!

What's differents between package vs library?!

packagesdifferencelibrarydifferentsdifferentvspackage
11th May 2020, 8:47 PM
Abdulmalek Mohammed Jayash
Abdulmalek Mohammed Jayash - avatar
2 Respostas

Costuma ter perguntas como essa?

Aprenda de maneira mais eficiente, de graça:

  • Introdução ao Python

    7.1M de alunos

  • Introdução ao Java

    4.7M de alunos

  • Introdução ao C

    1.5M alunos

  • Introdução ao HTML

    7.5M alunos

Ver todos os cursos
Quente hoje
Hofstadter a sequence code coach is not running
0 Votes
DSA doubt
1 Votes
the code for bigneer is not really what to do after coding begeneer in sololearn
0 Votes
Input errors (python)
1 Votes
Data structure using C
0 Votes
Vote Code
1 Votes
Without degree job
0 Votes
I wanna know is that what about dot net developers in future there is possible they gonna downfall in industry
0 Votes
Welcome to my portfolio. Here you'll find a collection of my projects and creations. I specialize in [Your Specialization, e.g.
0 Votes
How can I add gradient to the background
0 Votes