Courses
LoginStart now
Courses
LoginStart now
0

How to modeling with petri net ?

Plz give me any cours or Book that explain how to modeling sys with petri net i have exam in this

softwaremodelingsoftwareengineeringpetrinetsystemformelle
9th May 2022, 10:46 AM
Izmiir
Izmiir - avatar
0 odpowiedzi

Często masz takie pytania?

Ucz się bardziej efektywnie, za darmo:

  • Wprowadzenie do Pythona

    7.1M uczących się

  • Wprowadzenie do Java

    4.7M uczących się

  • Wprowadzenie do C

    1.5M uczących się

  • Wprowadzenie do HTML

    7.5M uczących się

Zobacz wszystkie kursy
Popularne dzisiaj
Hofstadter a sequence code coach is not running
0 Votes
DSA doubt
1 Votes
the code for bigneer is not really what to do after coding begeneer in sololearn
0 Votes
Input errors (python)
1 Votes
Data structure using C
0 Votes
Vote Code
1 Votes
Without degree job
0 Votes
I wanna know is that what about dot net developers in future there is possible they gonna downfall in industry
0 Votes
Welcome to my portfolio. Here you'll find a collection of my projects and creations. I specialize in [Your Specialization, e.g.
0 Votes
How can I add gradient to the background
0 Votes