Sesiones de PyR

I am a self learned developer not from computer science background is there any chance to make career in the development field?
androidcodeplaygroundcsshtmljavanode.jspythonself-learningweb-storagewebsite
0 Votos
2 Respuestas
14th Sep 2019, 4:07 PM
Prashant kushagra
Prashant kushagra - avatar
SHARE best LINKS for Programming
c#c++cpythonhtmlhtml5javajavascriptmysqlpythonpython3rubysqlweb-storagewebsitexhtml
1 Voto
6 Respuestas
15th Dec 2016, 1:43 PM
Mukharbek Organokov
Mukharbek Organokov - avatar
Has anybody here got a web development job as a freelancer?
csscss3htmlhtml5phpweb-developerweb-storagewebsite
-1 Voto
1 Respuesta
7th Mar 2021, 3:04 AM
Mousin Ahanger
Mousin Ahanger - avatar
Web and db
databasehtmljavascriptmysqlphpsqltablesweb-storagewebsite
0 Votos
1 Respuesta
26th Aug 2018, 3:16 PM
JaNieWiem
JaNieWiem - avatar
selolearn is our god
c#c++calculatorhtmljavajavascriptpythonweb-storagewebsitexhtml
0 Votos
2 Respuestas
1st Feb 2017, 5:30 PM
Subash Dahal
Subash Dahal - avatar
Any software to automate coding?
codecollectionsconstantsdecoratorsgradientspointerspositioningsubscriptweb-storage
-5 Votos
2 Respuestas
12th Sep 2020, 2:10 PM
Qwesi
Handle the traffic
html5javascriptmysqlphpservertrafficweb-storagewebsitexhtml
0 Votos
1 Respuesta
27th Aug 2017, 1:21 PM
Ashwani Kumar
Ashwani Kumar - avatar
Where can i find very simple python django projects with explanation of it and steps to deploy it?
codecssdjangoexceptionsjavajavascriptpythonweb-storagewebsite
0 Votos
1 Respuesta
25th Jul 2017, 3:18 PM
Pyrizard 🌟
Pyrizard 🌟 - avatar
Which Frameworks​ we should know?
bootstraphtmlhtml5javajavascriptjqueryphpweb-storagewebsitexhtml
0 Votos
2 Respuestas
14th Jun 2017, 9:43 AM
Pamod Banjitha (Banji)
Pamod Banjitha (Banji) - avatar
< Anterior1...910Siguiente >
En tendencia hoy
Hofstadter a sequence code coach is not running
0 Votes
DSA doubt
1 Votes
Vote Code
1 Votes
the code for bigneer is not really what to do after coding begeneer in sololearn
0 Votes
I wanna know is that what about dot net developers in future there is possible they gonna downfall in industry
0 Votes
Input errors (python)
1 Votes
Data structure using C
0 Votes
Without degree job
0 Votes
How can I add gradient to the background
0 Votes
Html learn
1 Votes