Courses
LoginStart now
Courses
LoginStart now
0

Package vs library ??!

What's differents between package vs library?!

packagesdifferencelibrarydifferentsdifferentvspackage
11th May 2020, 8:47 PM
Abdulmalek Mohammed Jayash
Abdulmalek Mohammed Jayash - avatar
2 Respuestas

¿Tienes a menudo preguntas como esta?

Aprende gratis de forma más eficaz

  • Introducción a Python

    7,1M de estudiantes

  • Introducción a Java

    4,7M de estudiantes

  • Introducción a C

    1,5M de estudiantes

  • Introducción a HTML

    7,5M de estudiantes

Ver todos los cursos
En tendencia hoy
Fast coding (mobile)
1 Votes
..
1 Votes
Hofstadter a sequence code coach is not running
0 Votes
DSA doubt
1 Votes
Coding help
2 Votes
Bridge pattern use case
0 Votes
Data structure using C
0 Votes
Input errors (python)
1 Votes
the code for bigneer is not really what to do after coding begeneer in sololearn
0 Votes
Without degree job
0 Votes