Q&A Discussions

Code playground slim UI option....
codeplaygroundslimui
3 Votes
4 Answers
23rd Feb 2018, 6:32 PM
Rishabh Agrawal
Rishabh Agrawal - avatar
Weapon options are slim
challengesweapons
0 Votes
1 Answer
6th Jun 2019, 3:21 PM
Lee Howard
Lee Howard - avatar
HTML Haml markdown Slim Pug
css3html5markdownpugslim
3 Votes
2 Answers
27th Jul 2019, 7:58 AM
Najmuddin Ansari
Najmuddin Ansari - avatar
What is slim UI in codeplayground?
codeplayground
0 Votes
3 Answers
21st May 2018, 5:06 AM
Hanumant Verma
Hanumant Verma - avatar
What is mean by slim Ul in options of code playground?
slimul
2 Votes
2 Answers
8th May 2019, 5:15 AM
One Republic
One Republic - avatar
Angular 5 Display JSON Data from HTTP Get Request
angularphpslim
11 Votes
1 Answer
26th Feb 2018, 1:42 PM
Jully Fredy
Jully Fredy - avatar
TODOs in external dependencies
packagistphpslimtodo
1 Vote
6 Answers
20th Jul 2020, 12:08 PM
Ore
Ore - avatar
What are ways of compacting C# code?
c#codecodeslimhelpslim
1 Vote
1 Answer
15th Aug 2018, 4:03 PM
Ethan
Ethan - avatar
I really am stuck on SQL EXAM 3/3 and have finished all lessons..Can I have help w/ 'Slim' the Giraffe help
3/3animalsgiraffehelpmysqlslimsqltestzoo
0 Votes
2 Answers
4th Sep 2022, 4:37 PM
Mike Jones
Mike Jones - avatar
Hot today
Hofstadter a sequence code coach is not running
0 Votes
DSA doubt
1 Votes
Vote Code
1 Votes
the code for bigneer is not really what to do after coding begeneer in sololearn
0 Votes
Input errors (python)
1 Votes
I wanna know is that what about dot net developers in future there is possible they gonna downfall in industry
0 Votes
Without degree job
0 Votes
Data structure using C
0 Votes
Je cherche des gens qui parle français pour apprendre le langage c
0 Votes
How can I add gradient to the background
0 Votes