Courses
LoginStart now
Courses
LoginStart now
0

Package vs library ??!

What's differents between package vs library?!

packagesdifferencelibrarydifferentsdifferentvspackage
11th May 2020, 8:47 PM
Abdulmalek Mohammed Jayash
Abdulmalek Mohammed Jayash - avatar
2 Antworten

Häufig solche Fragen?

Effizienter lernen, kostenlos:

  • Einführung in Python

    7.1M Lernende

  • Einführung in Java

    4.7M Lernende

  • Einführung in C

    1.5M Lernende

  • Einführung in HTML

    7.5M Lernende

Alle Kurse anzeigen
Heute heiß
Fast coding (mobile)
1 Votes
..
1 Votes
Hofstadter a sequence code coach is not running
0 Votes
DSA doubt
1 Votes
Coding help
2 Votes
Bridge pattern use case
0 Votes
Data structure using C
0 Votes
Input errors (python)
1 Votes
the code for bigneer is not really what to do after coding begeneer in sololearn
0 Votes
Without degree job
0 Votes